Description

  • Product name

    Recombinant Human ME2 protein
    See all ME2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALR FHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVG LACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERIL GLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPF YMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLR KYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAAL GIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTH SAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIF ALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNN VYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLA NIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLP DVYEWPESASSPPVITE
    • Predicted molecular weight

      64 kDa
    • Amino acids

      19 to 584
    • Additional sequence information

      This product is for the mature full length protein. The transit peptide is not included. A single non-glycosylated polypeptide chain.

Specifications

Our Abpromise guarantee covers the use of ab201360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 mm filtered solution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Malate dehydrogenase
    • Malic enzyme 2
    • Malic enzyme 2 mitochondrial
    • Malic enzyme 2 NAD(+) dependent mitochondrial
    • Malic enzyme mitochondrial
    • Malic enzyme NAD(+) dependent mitochondrial
    • MAOM_HUMAN
    • ME 2
    • ME2
    • mitochondrial
    • NAD dependent malic enzyme mitochondrial
    • NAD ME
    • NAD-dependent malic enzyme
    • NAD-ME
    • ODS1
    • Pyruvic malic carboxylase
    see all
  • Sequence similarities

    Belongs to the malic enzymes family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

References

ab201360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up