Description

  • Product name

    Recombinant Human ME3 protein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQL GIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYR VLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLN SWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQC LPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGI NCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRIT KNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMVDSKG LIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGAFTE QILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKS VTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQE VSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEA FVRSLVYTPDYDSFTLD
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      24 to 590
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab238230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Malate dehydrogenase
    • Malic enzyme 3
    • Malic enzyme 3, NADP(+) dependent, mitochondrial
    • NADP ME
    • NADPME
    • Pyruvic malic carboxylase
    see all
  • Relevance

    Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+) dependent isoform, and a mitochondrial NAD(+) dependent isoform. This gene encodes a mitochondrial NADP(+) dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. ME3 is expressed predominantly in organs with a low division rate. Its catalytic activity is (S) malate + NADP+ = pyruvate + CO2 + NADPH.
  • Cellular localization

    Mitochondrion matrix.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238230.

References

ab238230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up