Description

  • Product name

    Recombinant Human MECR protein
  • Purity

    > 90 % SDS-PAGE.
    ab99325 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPI NPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPAN AGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQ PGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLG AEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTM VTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLC DLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      54 to 373
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.077% DTT, 0.316% Tris HCl, 20% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • AI195831
    • CGI 63
    • FASN2B
    • Homolog of yeast 2 enoyl thioester reductase
    • HsNrbf-1
    • HsNrbf1
    • mecr
    • MECR_HUMAN
    • mitochondrial
    • Mitochondrial 2 enoyl thioester reductase
    • NRBF 1
    • NRBF-1
    • NRBF1
    • Nuclear receptor binding factor 1
    • Nuclear receptor-binding factor 1
    • OTTMUSP00000009996
    • RP23-13A13.1
    • Trans 2 enoyl CoA reductase, mitochondrial
    • Trans-2-enoyl-CoA reductase
    see all
  • Function

    Catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. May have a role in the mitochondrial synthesis of fatty acids.
  • Tissue specificity

    Highly expressed in skeletal and heart muscle. Expressed at lower level in placenta, liver, kidney and pancreas. Weakly or not expressed in lung.
  • Sequence similarities

    Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99325 (3µg).

References

ab99325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up