Overview

  • Product name

    Recombinant Human MED12 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      QPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYT QNQPLPAGGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMTGVMGLEPSSY KTSVYRQQQPAVP
    • Amino acids

      1829 to 1941
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Activator recruited cofactor 240 kDa component
    • Activator-recruited cofactor 240 kDa component
    • ARC240
    • CAG repeat protein 45
    • CAGH45
    • HOPA
    • KIAA0192
    • MED12
    • MED12_HUMAN
    • Mediator complex subunit 12
    • Mediator of RNA polymerase II transcription subunit 12
    • OPA containing protein
    • OPA-containing protein
    • Thyroid hormone receptor associated protein complex 230 kDa component
    • Thyroid hormone receptor-associated protein complex 230 kDa component
    • TNRC11
    • Trap230
    • Trinucleotide repeat containing gene 11 protein
    • Trinucleotide repeat-containing gene 11 protein
    see all
  • Function

    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. This subunit may specifically regulate transcription of targets of the Wnt signaling pathway and SHH signaling pathway.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in MED12 are the cause of Opitz-Kaveggia syndrome (OKS) [MIM:305450]; also known as FG syndrome type 1 (FGS1) or FG syndrome (FGS). OKS is an X-linked disorder characterized by mental retardation, relative macrocephaly, hypotonia and constipation.
    Defects in MED12 are the cause of Lujan-Fryns syndrome (LUJFRYS) [MIM:309520]; also known as X-linked mental retardation with marfanoid habitus. Clinically, Lujan-Fryns syndrome can be distinguished from Opitz-Kaveggia syndrome by tall stature, hypernasal voice, hyperextensible digits and high nasal root.
  • Sequence similarities

    Belongs to the Mediator complex subunit 12 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153031 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up