Description

  • Product name

    Recombinant Human MEG1 protein (denatured)
    See all MEG1 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMVLTQFDQLYRKKPGMTMSCAKLPQNISKN RYRDISPYDATRVILKGNEDYINANYINMEIPSSSIINQYIACQGPLPHT CTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTC HSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDF VCHVRNKRAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDI VRTMRDQRAMMIQTPSQYRFVCEAILKVYE
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      655 to 913
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Tyrosine-protein phosphatase domain of MEG1. NP_002821
  • Description

    Recombinant Human MEG1 protein

Specifications

Our Abpromise guarantee covers the use of ab202601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 90% Tris buffer

General Info

  • Alternative names

    • MEG
    • megakaryocyte phosphatase
    • megakaryocyte protein-tyrosine phosphatase
    • Protein tyrosine phosphatase MEG1
    • Protein tyrosine phosphatase, megakaryocyte
    • protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)
    • Protein-tyrosine phosphatase MEG1
    • PTN4
    • PTN4_HUMAN
    • PTPase MEG1
    • PTPase-MEG1
    • PTPMEG
    • PTPMEG1
    • Ptpn4
    • Tyrosine protein phosphatase non receptor type 4
    • Tyrosine-protein phosphatase non-receptor type 4
    see all
  • Function

    May act at junctions between the membrane and the cytoskeleton.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.
    Contains 1 FERM domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cell membrane. Cytoplasm, cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg of ab202601.

References

ab202601 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up