Description

  • Product name

    Recombinant human MEK5 protein
  • Biological activity

    The specific activity is 85 nmol/min/mg.

  • Purity

    > 85 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQ VLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIE PLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSA ELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLD ITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLD VYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCM RKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEERRSQQGPP
    • Predicted molecular weight

      77 kDa including tags
    • Amino acids

      1 to 448
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      BC008838

Associated products

Specifications

Our Abpromise guarantee covers the use of ab204150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 25% Glycerol, 0.002% PMSF, 0.87% Sodium chloride, 0.004% DTT, 0.307% Glutathione, 0.003% EDTA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Dual specificity mitogen activated protein kinase kinase 5
    • Dual specificity mitogen-activated protein kinase kinase 5
    • EC 2.7.12.2
    • HsT17454
    • MAP kinase kinase 5
    • MAP kinase kinase MEK5b
    • MAP2K5
    • MAPK/ERK kinase 5
    • MAPKK 5
    • MAPKK5
    • MEK 5
    • mitogen-activated protein kinase kinase 5
    • MKK5
    • MP2K5_HUMAN
    • PRKMK5
    • Protein kinase, mitogen-activated, kinase 5
    • SAPKK5
    • SKK5
    see all
  • Function

    Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appear to play a critical role in protecting cells from stress-induced apopotosis, neuronal survival and cardiac development and angiogenesis.
  • Tissue specificity

    Expressed in many adult tissues. Abundant in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 OPR domain.
    Contains 1 protein kinase domain.
  • Domain

    Binds MAP3K2/MAP3K3 and MAPK7 via non-overlapping residues of the OPR domain. This domain also mediates interactions with SQSTM1 and PARD6A.
  • Post-translational
    modifications

    Activated by phosphorylation on Ser/Thr by MAP kinase kinase kinases.
    Yersinia yopJ may acetylate Ser/Thr residues, preventing phosphorylation and activation, thus blocking the MAPK signaling pathway.
  • Information by UniProt

Images

  • The specific activity of MEK5 (ab204150) was determined to be 40.4 nmol/min/mg as per activity assay protocol and was equivalent to 72 nmol/min/mg as per radiometric assay
  • SDS PAGE analysis of ab204150
  • SDS PAGE analysis of ab204150
  • Sample Kinase Activity Plot. ab204150 specific activity was determined to be 85 nmol/min/mg.

  • SDS-PAGE analysis ofab204150. MW 77 KDa.

References

ab204150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up