Recombinant Human MelanA protein (ab114312)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, WB, ELISA
Description
-
Product name
Recombinant Human MelanA protein
See all MelanA proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRR RNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNA PPAYEKLSAEQSPPPYSP -
Predicted molecular weight
39 kDa including tags -
Amino acids
1 to 118 -
Tags
GST tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab114312 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Western blot
ELISA
-
Form
Liquid -
Additional notes
Protein concentration is above or equal to 0.05 mg/mL.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Antigen LB39 AA
- Antigen LB39-AA
- Antigen SK29 AA
see all -
Function
Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes. -
Tissue specificity
Expression is restricted to melanoma and melanocyte cell lines and retina. -
Post-translational
modificationsAcylated. -
Cellular localization
Endoplasmic reticulum membrane. Golgi apparatus. Golgi apparatus > trans-Golgi network membrane. Melanosome. Also found in small vesicles and tubules dispersed over the entire cytoplasm. A small fraction of the protein is inserted into the membrane in an inverted orientation. Inversion of membrane topology results in the relocalization of the protein from a predominant Golgi/post-Golgi area to the endoplasmic reticulum. Melanoma cells expressing the protein with an inverted membrane topology are more effectively recognized by specific cytolytic T-lymphocytes than those expressing the protein in its native membrane orientation. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab114312 has been referenced in 1 publication.
- Fässler M et al. Antibodies as biomarker candidates for response and survival to checkpoint inhibitors in melanoma patients. J Immunother Cancer 7:50 (2019). PubMed: 30786924