Overview

  • Product name

    Recombinant Human Melanophilin protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGKKLDLSKLTDEEAQHVLEVVQRDFDLRRKEEERLEALKGKIKKESSKR ELLSDTAHLNETHCARCLQPYQLLVNSKRQCLECGLFTCKSCGRVHPEEQ GWICDPCHLARVVKIGSLEWYYEHVKARFKRFGSAKVIRSLHGRLQGGAG PELISEERSGDSDQTDEDGEPGSEAQAQAQPFGSKKKRLLSVHDFDFEGD SDDSTQPQGHSLHLSSVPEARDSPQSLTDESCSEKAAPHKAEGLEEADTG ASGCHSHPEEQPTSISPSRHGALAELCPPGGSHRMALGTAAALGSNVIRN EQLPLQYLADVDTSDEESIRAHVMASHHSKRRGRASSESQIFELNKHISA VECLLTYLENTVVPPLAKGLGAGVRTEADVEEEALRRKLEELTSNVSDQE TSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGD PVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTV KPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRK FSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS
    • Molecular weight

      92 kDa including tags
    • Amino acids

      1 to 600
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab131880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2210418F23Rik
    • 5031433I09Rik
    • AW228792
    • D1Wsu84e
    • Exophilin 3
    • Exophilin-3
    • l(1)-3Rk
    • l1Rk3
    • Leaden
    • Leaden protein
    • ln
    • Melanophilin
    • MELPH_HUMAN
    • MGC2771
    • MGC59733
    • Mlph
    • Slac 2a
    • SlaC2-a
    • Slp homolog lacking C2 domains a
    • Synaptotagmin like protein 2a
    • Synaptotagmin like protein lacking C2 domains A
    • Synaptotagmin-like protein 2a
    see all
  • Function

    Rab effector protein involved in melanosome transport. Serves as link between melanosome-bound RAB27A and the motor protein MYO5A.
  • Involvement in disease

    Defects in MLPH are a cause of Griscelli syndrome type 3 (GS3) [MIM:609227]. GS3 is a rare autosomal recessive disorder characterized by pigmentary dilution of the skin and hair, the presence of large clumps of pigment in hair shafts, and an accumulation of melanosomes in melanocytes, without other clinical manifestations.
  • Sequence similarities

    Contains 1 FYVE-type zinc finger.
    Contains 1 RabBD (Rab-binding) domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131880 at approximately 92.3 kDa.

References

ab131880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up