Description

  • Product name

    Recombinant Human Melatonin Receptor 1A/MTNR1A protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV KVDSV
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      296 to 350

Specifications

Our Abpromise guarantee covers the use of ab114688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as Melatonin Receptor 1A

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Mel 1A R
    • MEL-1A-R
    • Mel1a melatonin receptor
    • Mel1a receptor
    • Melatonin receptor 1A
    • Melatonin receptor type 1A
    • MelR
    • MR
    • MT 1
    • MT1
    • MTNR 1A
    • MTNR1A
    • MTR1A_HUMAN
    see all
  • Function

    High affinity receptor for melatonin. Likely to mediates the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.
  • Tissue specificity

    Expressed in hypophyseal pars tuberalis and hypothalamic suprachiasmatic nuclei (SCN). Hippocampus.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab114688 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up