Description

  • Product name

    Recombinant human MELK protein (Active)
    See all MELK proteins and peptides
  • Biological activity

    The specific activity of ab204155 was determined to be 210 nmol/min/mg.

  • Purity

    > 85 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSD LPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIIS QDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLID FGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLY VLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKK RISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQT MEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFT DIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWT ESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPV NKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVIS PERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKG SA
    • Predicted molecular weight

      88 kDa including tags
    • Amino acids

      1 to 550
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_014791.

Specifications

Our Abpromise guarantee covers the use of ab204155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.002% PMSF, 25% Glycerol, 0.00385% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AI327312
    • hMELK
    • HPK 38
    • hPK38
    • KIAA0175
    • Likely ortholog of maternal embryonic leucine zipper kinase
    • Maternal embryonic leucine zipper kinase
    • MELK
    • MELK_HUMAN
    • mKIAA0175
    • MPK38
    • OTTHUMP00000021377
    • OTTHUMP00000046113
    • pEg3 kinase
    • Protein kinase Eg3
    • Protein kinase PK38
    • RP23 382O11.1
    • Tyrosine protein kinase MELK
    see all
  • Function

    Phosphorylates ZNF622 and may contribute to its redirection to the nucleus. May be involved in the inhibition of spliceosome assembly during mitosis.
  • Tissue specificity

    Expressed in placenta, kidney, thymus, testis, ovary and intestine.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.
    Contains 1 KA1 (kinase-associated) domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Thr-478 phosphorylation during mitosis promotes interaction with PPP1R8.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • The specific activity of MELK (ab204155) was determined to be 140 nmol/min/mg as per activity assay protocol and was equivalent to 175 nmol/min/mg as per radiometric assay
  • SDS PAGE analysis of ab204155
  • SDS PAGE analysis of ab204155
  • The specific activity of ab204155 was determined to be 210 nmol/min/mg.

  • SDS-PAGE analysis of ab204155 which was determined to be >85% pure by densitometry.

References

ab204155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up