Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF SEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETL RRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQ NPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQ PGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQT ELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSW AQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE
    • Amino acids

      1 to 347
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as ITGB1BP2.
     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CHORDC3
    • Integrin beta 1 binding protein (melusin) 2
    • integrin beta 1 binding protein 2
    • ITGB1BP
    • ITGB1BP2
    • MELUSIN
    • MGC119214
    • MSTP015
    see all
  • Relevance

    Melusin is a muscle-specific protein that interacts with the Integrin 1 cytoplasmic domain, in the hypertrophic response to mechanical overload.
  • Cellular localization

    Plasma membrane

Images

  • ab162009 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up