Overview

  • Product name

    Recombinant Human MEOX 2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCII AGYPNEEGMFASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPP SAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAPGDYGR QALSPAEAEKRSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQG AAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSEH AHL
    • Molecular weight

      59 kDa including tags
    • Amino acids

      1 to 303

Specifications

Our Abpromise guarantee covers the use of ab114829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GAX
    • Growth arrest-specific homeobox
    • Homeobox protein MOX 2
    • Homeobox protein MOX-2
    • meox2
    • MEOX2_HUMAN
    • Mesenchyme homeobox 2
    • MOX2
    see all
  • Function

    Role in mesoderm induction and its earliest regional specification, somitogenesis, and myogenic and sclerotomal differentiation. May have a regulatory role when quiescent vascular smooth muscle cells reenter the cell cycle.
  • Tissue specificity

    Embryo and placenta.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab114829 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up