Overview

  • Product name

    Recombinant Human Meprin alpha protein (His tag)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPVPIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDILLQKSRNGL RDPNTRWTFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESS YIIFQQFDGCWSEVGDQHVGQNISIGQGCAYKAIIEHEILHALGFYHEQS RTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFS FNKNASVPTITAKIPEFNSIIGQRLDFSAIDLERLNRMYNCTTTHTLLDH CTFEKANICGMIQGTRDDTDWAHQDSAQAGEVDHTLLGQCTGAGYFMQFS TSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLVVWVRRDDST GNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGG IYLDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNSEGYGFG VTLYPNSRESSGYLRLAFHVCSGENDAILEWPVENRQVIITILDQEPDVR NRMSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCFRSIDLGWS GFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQHHHHHH
    • Molecular weight

      67 kDa including tags
    • Amino acids

      22 to 601
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_005579.

Specifications

Our Abpromise guarantee covers the use of ab219292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 85 % SDS-PAGE.
    ab219292 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • Endopeptidase 2
    • Endopeptidase-2
    • Mep1a
    • MEP1A_HUMAN
    • Meprin A alpha (PABA peptide hydrolase)
    • Meprin A alpha subunit precursor
    • Meprin A subunit alpha
    • N benzoyl L tyrosyl P amino benzoic acid hydrolase alpha subunit
    • N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit alpha
    • PABA peptide hydrolase
    • PPH alpha
    • PPHA
    see all
  • Sequence similarities

    Belongs to the peptidase M12A family.
    Contains 1 EGF-like domain.
    Contains 1 MAM domain.
    Contains 1 MATH domain.
  • Post-translational
    modifications

    N-glycosylated; contains GlcNAc, galactose, mannose and a small amount of fucose.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab219292.

    Molecular Weight: 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab219292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up