Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQP GRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP
    • Amino acids
      21 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • c MER
    • c mer proto oncogene tyrosine kinase
    • c-mer
    • cMER
    • cmer protooncogene tyrosine kinase
    • Eyk
    • MER
    • MER receptor tyrosine kinase
    • MERK
    • MERPEN
    • Mertk
    • MERTK c-mer proto-oncogene tyrosine kinase
    • MERTK_HUMAN
    • MGC133349
    • nmf12
    • Nyk
    • Proto oncogene tyrosine protein kinase MER
    • Proto oncogene tyrosine protein kinase MER precursor
    • Proto-oncogene c-Mer
    • Receptor tyrosine kinase MerTK
    • RP38
    • STK kinase
    • Tyrosine-protein kinase Mer
    see all
  • Function
    In case of filovirus infection, seems to function as a cell entry factor.
  • Tissue specificity
    Not expressed in normal B- and T-lymphocytes but is expressed in numerous neoplastic B- and T-cell lines.
  • Involvement in disease
    Defects in MERTK are the cause of retinitis pigmentosa type 38 (RP38) [MIM:613862]. RP38 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. AXL/UFO subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161003 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up