Description

  • Product name

    Recombinant Human Mesothelin protein (His tag)
    See all Mesothelin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EVEKTACPSGKKAPEIDESLIFYKKWELEACVDAALLATQMDRVNAIPFT YEQLDVLKHKLDELYPQGYPESVIQHLGYLFLKMSPEDIRKWNVTSLETL KALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLS PEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVK IQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGP HVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQE ALSHHHHHH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      296 to 598
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • CAK 1
    • CAK1
    • CAK1 antigen
    • cleaved form
    • Megakaryocyte potentiating factor
    • Mesothelin
    • Mesothelin isoform 1 precursor
    • MPF
    • Msln
    • MSLN_HUMAN
    • Pre pro megakaryocyte potentiating factor
    • Pre-pro-megakaryocyte-potentiating factor
    • SMR
    • SMRP
    • Soluble MPF mesothelin related protein
    see all
  • Function

    Membrane-anchored forms may play a role in cellular adhesion.
    Megakaryocyte-potentiating factor (MPF) potentiates megakaryocyte colony formation in vitro.
  • Tissue specificity

    Expressed in lung. Expressed at low levels in heart, placenta and kidney. Expressed in mesothelial cells. Highly expressed in mesotheliomas, ovarian cancers, and some squamous cell carcinomas (at protein level).
  • Involvement in disease

    Note=Antibodies against MSLN are detected in patients with mesothelioma and ovarian cancer.
  • Sequence similarities

    Belongs to the mesothelin family.
  • Post-translational
    modifications

    Both MPF and the cleaved form of mesothelin are N-glycosylated.
    Proteolytically cleaved by a furin-like convertase to generate megakaryocyte-potentiating factor (MPF), and the cleaved form of mesothelin.
  • Cellular localization

    Secreted and Cell membrane. Golgi apparatus.
  • Information by UniProt

References

ab215606 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up