For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-metallothionein-protein-tagged-ab112324.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Domain Families Zinc Finger
Share by email

Recombinant Human Metallothionein protein (Tagged) (ab112324)

  • Datasheet
Submit a review Q&A (4)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Metallothionein protein (Tagged) (ab112324)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: SDS-PAGE, ELISA, WB

    Description

    • Product name

      Recombinant Human Metallothionein protein (Tagged)
    • Expression system

      Wheat germ
    • Accession

      P02795
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCIC KGASDKCSCCA
      • Predicted molecular weight

        33 kDa including tags
      • Amino acids

        1 to 61
      • Tags

        GST tag N-Terminus

    Specifications

    Our Abpromise guarantee covers the use of ab112324 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      ELISA

      Western blot

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.31% Glutathione, 0.79% Tris HCl

    General Info

    • Alternative names

      • CES 1
      • CES1
      • Metallothionein 1A
      • Metallothionein 1S
      • Metallothionein 2
      • Metallothionein 2A
      • Metallothionein IA
      • Metallothionein II
      • Metallothionein-1A
      • Metallothionein-IA
      • Metallothionein2
      • MGC32848
      • MT 1A
      • MT 2
      • MT 2A
      • MT IA
      • MT II
      • MT-1A
      • MT-IA
      • MT1
      • MT1A
      • MT1A_HUMAN
      • MT1S
      • MT2
      • MT2A
      • MTC
      see all
    • Function

      Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
    • Sequence similarities

      Belongs to the metallothionein superfamily. Type 1 family.
    • Domain

      Class I metallothioneins contain 2 metal-binding domains: four divalent ions are chelated within cluster A of the alpha domain and are coordinated via cysteinyl thiolate bridges to 11 cysteine ligands. Cluster B, the corresponding region within the beta domain, can ligate three divalent ions to 9 cysteines.
    • Target information above from: UniProt accession P04731 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Metallothionein protein (Tagged) (ab112324)
      SDS-PAGE - Recombinant Human Metallothionein protein (Tagged) (ab112324)
      ab112324 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab112324? Please let us know so that we can cite the reference in this datasheet.

    ab112324 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-4 of 4 Abreviews or Q&A

    Question

    Is there a protease cleavage site present between the GST and metallotheonein?

    Read More

    Abcam community

    Verified customer

    Asked on Mar 06 2014

    Answer

    The tag is at the N-terminus and it could be cleavaged from the fusion protein by PreScission Protease (Amersham Biosciences).

    Read More

    Jeremy Kasanov

    Abcam Scientific Support

    Answered on Mar 06 2014

    Question

    To whom it may concern,

    I wish to seek some proteins
    Metallothionein 1X
    Metallothionein 2A

    Any help would be greatly appreciated

    Many thanks,

    Read More

    Abcam community

    Verified customer

    Asked on Dec 13 2012

    Answer

    Thank you for your enquiry.

    I can confirm we do have one Matallothionein protein available in the catalog:

    ab112324
    https://www.abcam.com/Recombinant-Human-Metallothionein-protein-Tagged-ab112324.html (or use the following: https://www.abcam.com/Recombinant-Human-Metallothionein-protein-Tagged-ab112324.html).

    I have confirmed with the originator that this is Metallothionein 2A protein (GeneID: 4502).

    I am sorry we do not have Metallothionein 1X.

    I hope this will be helpful to you. If you have any further questions, please do not hesitate to contact us.

    Read More

    Abcam Scientific Support

    Answered on Dec 13 2012

    Question

    Would like MSDS for this protein.

    Read More

    Abcam community

    Verified customer

    Asked on Dec 08 2011

    Answer

    Thanks for your call today and for your patience. Please find the MSDS attached to this email. Let me know if you have any questions or if there is anything else that we can do for you.

    Read More

    Abcam Scientific Support

    Answered on Dec 08 2011

    Question

    Please send MSDS sheet.

    Read More

    Abcam community

    Verified customer

    Asked on Nov 28 2011

    Answer

    Thank you for calling Abcam. Please find attached the MSDS for ab112324. If there is anything else I can help you with, please let me kn

    Read More

    Abcam Scientific Support

    Answered on Nov 28 2011

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.