Overview

Description

  • Nature
    Recombinant
  • Source
    Insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSA AGEQEPDKESGASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKK KKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTAAWRT TSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKL EDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKI DFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDV GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGG EATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTK HLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDI KGSYTAQFEHTILLRPTCKEVVSRGDDY
    • Molecular weight
      70 kDa including tags
    • Amino acids
      1 to 478

Specifications

Our Abpromise guarantee covers the use of ab168057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    ab168057 was purified by chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 0.48% HEPES, 10% Glycerol, 0.88% Sodium chloride, 0.001% Cobalt chloride

General Info

  • Alternative names
    • A930035J23Rik
    • AI047573
    • AL024412
    • Amp2
    • AU014659,
    • EIF 2 associated p67 homolog
    • EIF-2-associated p67
    • Initiation factor 2 associated 67 kDa glycoprotein
    • Initiation factor 2-associated 67 kDa glycoprotein
    • MAP 2
    • MAP2
    • MAP2_HUMAN
    • MetAP 2
    • Metap2
    • Methionine aminopeptidase 2
    • Methionyl aminopeptidase 2
    • MGC102452
    • MGC127390
    • MGC53792
    • MNPEP
    • p67
    • p67eIF2
    • Peptidase M
    • Peptidase M2
    see all
  • Function
    Cotranslationally removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). The catalytic activity of human METAP2 toward Met-Val peptides is consistently two orders of magnitude higher than that of METAP1, suggesting that it is responsible for processing proteins containing N-terminal Met-Val and Met-Thr sequences in vivo.
    Protects eukaryotic initiation factor EIF2S1 from translation-inhibiting phosphorylation by inhibitory kinases such as EIF2AK2/PKR and EIF2AK1/HCR. Plays a critical role in the regulation of protein synthesis.
  • Sequence similarities
    Belongs to the peptidase M24A family. Methionine aminopeptidase eukaryotic type 2 subfamily.
  • Post-translational
    modifications
    Contains approximately 12 O-linked N-acetylglucosamine (GlcNAc) residues. O-glycosylation is required for EIF2S1 binding.
  • Cellular localization
    Cytoplasm. About 30% of expressed METAP2 associates with polysomes.
  • Information by UniProt

References

ab168057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up