Recombinant Human Methionine Aminopeptidase 2/p67 protein (His tag) (ab232796)

Description

  • Product name

    Recombinant Human Methionine Aminopeptidase 2/p67 protein (His tag)
    See all Methionine Aminopeptidase 2/p67 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Baculovirus
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AGVEEVAASGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGPSAA GEQEPDKESGASVDEVARQLERSALEDKERDEDDEDGDGDGDGATGKKKK KKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGRTAAWRTT SEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLE DCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTVLQYDDICKID FGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDVG EAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGE ATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKH LLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIK GSYTAQFEHTILLRPTCKEVVSRGDDY
    • Predicted molecular weight

      53 kDa
    • Amino acids

      2 to 478
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Myc tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab232796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Methionine Aminopeptidase 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • A930035J23Rik
    • AI047573
    • AL024412
    • Amp2
    • AU014659,
    • EIF 2 associated p67 homolog
    • EIF-2-associated p67
    • Initiation factor 2 associated 67 kDa glycoprotein
    • Initiation factor 2-associated 67 kDa glycoprotein
    • MAP 2
    • MAP2
    • MAP2_HUMAN
    • MetAP 2
    • Metap2
    • Methionine aminopeptidase 2
    • Methionyl aminopeptidase 2
    • MGC102452
    • MGC127390
    • MGC53792
    • MNPEP
    • p67
    • p67eIF2
    • Peptidase M
    • Peptidase M2
    see all
  • Function

    Cotranslationally removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). The catalytic activity of human METAP2 toward Met-Val peptides is consistently two orders of magnitude higher than that of METAP1, suggesting that it is responsible for processing proteins containing N-terminal Met-Val and Met-Thr sequences in vivo.
    Protects eukaryotic initiation factor EIF2S1 from translation-inhibiting phosphorylation by inhibitory kinases such as EIF2AK2/PKR and EIF2AK1/HCR. Plays a critical role in the regulation of protein synthesis.
  • Sequence similarities

    Belongs to the peptidase M24A family. Methionine aminopeptidase eukaryotic type 2 subfamily.
  • Post-translational
    modifications

    Contains approximately 12 O-linked N-acetylglucosamine (GlcNAc) residues. O-glycosylation is required for EIF2S1 binding.
  • Cellular localization

    Cytoplasm. About 30% of expressed METAP2 associates with polysomes.
  • Information by UniProt

References

ab232796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up