Description

  • Product name

    Recombinant Human METTL1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab103495 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPM ADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEF ADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGG FQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTL LAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPV VGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      1 to 276
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • C12orf1
    • D1075 like gene product
    • FLJ95748
    • Methyltransferase like 1
    • Methyltransferase like protein 1
    • Methyltransferase-like protein 1
    • Mettl1
    • TRM8
    • TRMB_HUMAN
    • TRMT8
    • tRNA (guanine N(7) ) methyltransferase
    • tRNA (guanine(46)-N(7))-methyltransferase
    • tRNA (guanine-N(7)-)-methyltransferase
    • tRNA(m7G46) methyltransferase
    • tRNA(m7G46)-methyltransferase
    • YDL201w
    see all
  • Function

    Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.
  • Tissue specificity

    Ubiquitous.
  • Pathway

    tRNA modification; N(7)-methylguanine-tRNA biosynthesis.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. TrmB family.
  • Post-translational
    modifications

    Phosphorylation at Ser-27 inactivates its catalytic activity but does not affect the interaction with WDR4.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103495.

References

ab103495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up