Description

  • Product name

    Recombinant Human METTL10 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFR EYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKF GFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHIC IDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFSNNVM
    • Amino acids

      1 to 192
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Methyltransferase-like protein 10. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C10orf138
    • Chromosome 10 open reading frame 138
    • EC 2.1.1.-
    • Em:AC068896.3
    • FLJ13019
    • LOC399818
    • Methyltransferase like 10
    • Methyltransferase-like protein 10
    • Mettl10
    • MTL10_HUMAN
    • OTTHUMP00000020696
    see all
  • Sequence similarities

    Belongs to the methyltransferase superfamily.
  • Information by UniProt

Images

  • ab166485 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166485 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up