Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQ RFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQA KTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFL RRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLS LLAEERQENLPDEIYHVYSFALR
    • Amino acids

      1 to 223
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AD 003
    • Alpha N-terminal protein methyltransferase 1A
    • C9orf32
    • Chromosome 9 open reading frame 32
    • Methyltransferase like 11A
    • Methyltransferase-like protein 11A
    • Mettl11a
    • N-terminal RCC1 methyltransferase
    • NRMT
    • NTM1A
    • NTM1A_HUMAN
    • NTMT1
    • X-Pro-Lys N-terminal protein methyltransferase 1A
    see all
  • Function

    Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala, Pro or Ser residue in the [Ala/Pro/Ser]-Pro-Lys motif. Mediates the N-terminal methylation of KLHL31, MYL2, MYL3, RB1, RCC1, RPL23A and SET. Required during mitosis for normal bipolar spindle formation and chromosome segregation.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. NTM1 family.
  • Cellular localization

    Nucleus. Predominantly nuclear.
  • Information by UniProt

Images

  • ab162200 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up