Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADLVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIY PSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADG EYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEE DGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFW FRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRAHHH HHH
    • Molecular weight

      28 kDa including tags
    • Amino acids

      22 to 255
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab219453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • MFAP4
    • MFAP4_HUMAN
    • Microfibril-associated glycoprotein 4
    • Microfibrillar associated protein 4
  • Function

    Could be involved in calcium-dependent cell adhesion or intercellular interactions.
  • Involvement in disease

    MFAP4 is deleted in the Smith-Magenis syndrome (SMS) [MIM:182290].
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3ug of ab219453. Molecular Weight: 27.5kDa; 28-40KDa (SDS-PAGE under reducing conditions.)

    Lane 1: Reduced form

    Lane 2: Non-Reduced form

References

ab219453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up