Overview

  • Product name

    Recombinant Human MFSD6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGCKPPEYRNYQIVFIVFGVL MTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESSEETPTTTS HSQAFNFWDLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGT TTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYIS YLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLH LGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWLAVPDE EEDKTMLAERIPVPSSPVPIATIDLVQQQTEDVMPRIEPRLPPKKTKHQE EQEDVNKPAWGVSSSPWVTFVYALYQIKEMMQLTRDNRASEIQPLQGTNE NRENSPAGRAQPVPCETHSDPSRNQPSPDAAASQTQTSPAHPSVDPCTEE SEEQQAQLAAGGH
    • Amino acids

      1 to 463
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ20160
    • HMMR2
    • macrophage MHC class I receptor 2 homolog
    • Macrophage MHC class I receptor 2 homolog
    • Macrophage MHC receptor 2
    • Major facilitator superfamily domain containing protein 6
    • MFSD6
    • MMR2
    • OTTHUMP00000163510
    • OTTHUMP00000205546
    • OTTHUMP00000205548
    see all
  • Relevance

    This protein may interact with HLA-B62.
  • Cellular localization

    Membrane

Images

  • ab162858 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up