Overview

  • Product name

    Recombinant Human MGAT3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFF WNNAPVTPQASPEPGGPDLLRTPLYSHSPLLQPLPPSKAAEELHRVDLVL PEDTTEYFVRTKAGGVCFKPGTKMLERPPPGRPEEKPEGANGSSARRPPR YLLSARERTGGRGARRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLV PREVPRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYGEPRP LKFREMLTNGTFEYIRHKVLYVFLDHFPPGGRQDGWIADDYLRTFLTQDG VSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYG FFWKQPGTLEVVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTG HILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKR DLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDN PYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV
    • Amino acids

      1 to 533
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
    • Beta 1 4 mannosyl glycoprotein 4 beta N acetylglucosaminyltransferase
    • Beta-1
    • FLJ43371
    • GlcNAc T III
    • GlcNAc-T III
    • GNT 3
    • GNT III
    • GNT-III
    • GNT3
    • Mannosyl (beta 1 4 ) glycoprotein beta 1 4 N acetylglucosaminyltransferase
    • MGAT 3
    • MGAT3
    • MGAT3_HUMAN
    • MGC141943
    • MGC142278
    • N acetylglucosaminyltransferase III
    • N glycosyl oligosaccharide glycoprotein N acetylglucosaminyltransferase III
    • N-acetylglucosaminyltransferase III
    • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III
    • OTTHUMP00000042207
    see all
  • Function

    It is involved in the regulation of the biosynthesis and biological function of glycoprotein oligosaccharides. Catalyzes the addition of N-acetylglucosamine in beta 1-4 linkage to the beta-linked mannose of the trimannosyl core of N-linked sugar chains. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 17 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab158888 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up