Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRVAGTRTDVNELLQRWTPRCVRWHTGGARRVALDRPLVTACLPPAGDV VDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGD GNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLLAKESSLQPAVRV GQGRTGVSVVMGIPSVRREVHSYLTDTLHSLISELSPQEKEDSVIVVLIA ETDSQYTSAVTENIKALFPTEIHSGLLEVISPSPHFYPDFSRLRESFGDP KERVRWRTKQNLDYCFLMMYAQSKGIYYVQLEDDIVAKPNYLSTMKNFAL QQPSEDWMILEFSQLGFIGKMFKSLDLSLIVEFILMFYRDKPIDWLLDHI LWVKVCNPEKDAKHCDRQKANLRIRFKPSLFQHVGTHSSLAGKIQKLKDK DFGKQALRKEHVNPPAEVSTSLKTYQHFTLEKAYLREDFFWAFTPAAGDF IRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQE GRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPV WVILSEIFLKKAD
    • Amino acids
      1 to 563
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-D-mannoside beta-1
    • 3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
    • 4-N-acetylglucosaminyltransferase IVb
    • Alpha 1 3 mannosyl glycoprotein beta 1 4 N acetylglucosaminyltransferase
    • Alpha-1
    • Aminyltransferase
    • GlcNAc T IVb
    • GlcNAc-T IVb
    • GNT IV
    • GNT IVB
    • GnT-IVb
    • GNTIV
    • GNTIVB
    • Mannosyl (alpha 1 3) glycoprotein beta 1 4 N acetylglucosaminyltransferase isozyme B
    • MGAT 4B
    • mgat4b
    • MGT4B_HUMAN
    • N acetylglucosaminyltransferase IVb
    • N glycosyl oligosaccharide glycoprotein
    • N glycosyl oligosaccharide glycoprotein N acetylglucosaminyltransferase IVb
    • N-acetylglucosaminyltransferase IVb
    • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb
    • UDP N acetylglucosamine alpha 1 3 D mannoside beta 1 4 N acetylglucosaminyltransferase IV
    • UDP N acetylglucosamine alpha 1 3 D mannoside beta 1 4 N acetylglucosaminyltransferase IVb
    • UDP-N-acetylglucosamine: alpha-1
    see all
  • Function
    Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis.
  • Tissue specificity
    Widely expressed. Strongly overexpressed in pancreatic cancer.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 54 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161402 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up