Description

  • Product name

    Recombinant Human MGAT5 protein
    See all MGAT5 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDIL VPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      642 to 739

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
    • 6-N-acetylglucosaminyltransferase
    • Alpha 1,3(6) mannosylglycoprotein
    • Alpha 1,6 mannosylglycoprotein 6 beta N acetylglucosaminyltransferase
    • Alpha mannoside beta 1,6 N acetylglucosaminyltransferase
    • Alpha-1
    • Alpha-mannoside beta-1
    • Beta 1,6 N acetyl glucosaminyltransferase
    • GGNT5
    • GlcNAc T V
    • GlcNAc-T V
    • GNT V
    • GNT VA
    • GNT-V
    • GNTV
    • GNTVA
    • Mannoside acetylglucosaminyltransferase 5
    • Mannosyl (alpha 1,6) glycoprotein beta 1,6 N acetyl glucosaminyltransferase
    • Mgat5
    • MGT5A_HUMAN
    • N acetylglucosaminyl transferase V
    • N acetylglucosaminyltransferase V mannosyl (alpha 1,6) glycoprotein
    • N-acetylglucosaminyl-transferase V
    see all
  • Function

    Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 18 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114713 at approximately 36.41 kDa stained with Coomassie Blue.

References

ab114713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up