Description

  • Product name

    Recombinant Human MGAT5B protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRL GDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRA GGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVS EGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIY LSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKES LIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDV FSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQRQRRLRSSQ EQARCGVMGACEKMLLEGDVASNTLLIEKPSKKETEKCPKNLVT
    • Amino acids

      1 to 394
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
    • 6-N-acetylglucosaminyltransferase B
    • Alpha-1
    • Alpha-mannoside beta-1
    • GlcNAc-T Vb
    • GNT-IX
    • GNT-Vb
    • hGnTVb
    • Mannoside acetylglucosaminyltransferase 5B
    • Mgat5b
    • MGT5B_HUMAN
    • N-acetylglucosaminyl-transferase Vb
    • N-acetylglucosaminyltransferase IX
    see all
  • Function

    Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.
  • Tissue specificity

    Predominantly expressed in brain. Expressed in all area of the adult and fetal brain Also expressed at much lower level in testis, spleen and thymus.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 18 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab165538 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up