Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFYESHESMESYELNPFINRRNA NTFISPQQRWRAKV QERIRERSKPVHELNREACDDYRLCERYAMVYGY NAAYNRYF
    • Molecular weight

      13 kDa including tags
    • Amino acids

      20 to 96
    • Tags

      His tag N-Terminus , T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134875 was expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituents: Potassium chloride, 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, Glycerol, Sodium chloride, 3.4% DL-Arginine

General Info

  • Alternative names

    • Cell growth inhibiting gene 36 protein
    • Cell growth-inhibiting gene 36 protein
    • GAMMA-CARBOXYGLUTAMIC ACID PROTEIN, MATRIX
    • GIG36
    • Matrix Gla protein
    • MGLAP
    • MGP
    • MGP_HUMAN
    • NTI
    see all
  • Function

    Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation.
  • Involvement in disease

    Defects in MGP are the cause of Keutel syndrome (KS) [MIM:245150]. KS is an autosomal recessive disorder characterized by abnormal cartilage calcification, peripheral pulmonary stenosis neural hearing loss and midfacial hypoplasia.
  • Sequence similarities

    Belongs to the osteocalcin/matrix Gla protein family.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
  • Post-translational
    modifications

    Requires vitamin K-dependent gamma-carboxylation for its function.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab134875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up