Description

  • Product name

    Recombinant Human MGP protein (denatured)
    See all MGP proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab113156 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMYESHESMESYELNPFINRRNANTFISPQQ RWRAKVQERIRERSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYF
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      20 to 96
    • Tags

      His tag N-Terminus
  • Description

    Recombinant Human MGP protein

Specifications

Our Abpromise guarantee covers the use of ab113156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Cell growth inhibiting gene 36 protein
    • Cell growth-inhibiting gene 36 protein
    • GAMMA-CARBOXYGLUTAMIC ACID PROTEIN, MATRIX
    • GIG36
    • Matrix Gla protein
    • MGLAP
    • MGP
    • MGP_HUMAN
    • NTI
    see all
  • Function

    Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation.
  • Involvement in disease

    Defects in MGP are the cause of Keutel syndrome (KS) [MIM:245150]. KS is an autosomal recessive disorder characterized by abnormal cartilage calcification, peripheral pulmonary stenosis neural hearing loss and midfacial hypoplasia.
  • Sequence similarities

    Belongs to the osteocalcin/matrix Gla protein family.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
  • Post-translational
    modifications

    Requires vitamin K-dependent gamma-carboxylation for its function.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab113156 (3 µg) at approximately 11.8 kDa.

References

ab113156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up