Description

  • Product name

    Recombinant Human MGP protein (Tagged)
    See all MGP proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      YESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRERSKPVHELN REACDDYRLCERYAMVYGYNAAYNRYF
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      20 to 96
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-tagged and C-terminal Myc-tagged. Full length mature chain without signal peptide and without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab235811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Cell growth inhibiting gene 36 protein
    • Cell growth-inhibiting gene 36 protein
    • GAMMA-CARBOXYGLUTAMIC ACID PROTEIN, MATRIX
    • GIG36
    • Matrix Gla protein
    • MGLAP
    • MGP
    • MGP_HUMAN
    • NTI
    see all
  • Function

    Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation.
  • Involvement in disease

    Defects in MGP are the cause of Keutel syndrome (KS) [MIM:245150]. KS is an autosomal recessive disorder characterized by abnormal cartilage calcification, peripheral pulmonary stenosis neural hearing loss and midfacial hypoplasia.
  • Sequence similarities

    Belongs to the osteocalcin/matrix Gla protein family.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
  • Post-translational
    modifications

    Requires vitamin K-dependent gamma-carboxylation for its function.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab235811.

References

ab235811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up