Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEG YLFGENMDLNFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYK DDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASEEFLNGRAVYSP KSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVI QAVVDEGDVVEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQ EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS CADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEH DEHSCPFKKSKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAV SPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQKGRPQSKA PDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRESSSPESFITE EVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPGRPTSMETAH GLATTSPTWPPLGGPSPDPSAAELTPL
    • Molecular weight
      96 kDa including tags
    • Amino acids
      2 to 576
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab167954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    > 90 % Densitometry.

  • Form
    Liquid
  • Additional notes

    Previously labelled as RNF156. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.004% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase MGRN1
    • KIAA0544
    • Mahogunin ring finger 1
    • Mahogunin RING finger protein 1
    • MGRN 1
    • Mgrn1
    • MGRN1_HUMAN
    • Probable E3 ubiquitin protein ligase MGRN1
    • RING finger protein 156
    • RNF 156
    • RNF156
    see all
  • Function
    E3 ubiquitin-protein ligase. Mediates monoubiquitination at multiple sites of TSG101 in the presence of UBE2D1, but not of UBE2G1, nor UBE2H. Plays a role in the regulation of endosome-to-lysosome trafficking. Impairs MC1R- and MC4R-signaling by competing with GNAS-binding to MCRs and inhibiting agonist-induced cAMP production. Does not inhibit ADRB2-signaling. Does not promote MC1R ubiquitination.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-type zinc finger.
  • Domain
    The RING finger is required for ubiquitin ligase activity.
  • Post-translational
    modifications
    Autoubiquitinated in vitro.
  • Cellular localization
    Cytoplasm > cytosol. Cell membrane; Early endosome. The endosomal localization is dependent on the interaction with TSG101 and Cytoplasm > cytosol. Nucleus. Translocation from the cytosol to the nucleus is seen only in the presence of MC1R and MC4R, but not TBXA2R. Excluded from nucleoli.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab167954.

References

ab167954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up