Overview

  • Product name

    Recombinant Human mH2A1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFSSRGGKKKSTKTSRSAKAGVI FPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNK KGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSKG KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASAD STTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNAD IDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKF VIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFP KQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN
    • Molecular weight

      43 kDa including tags
    • Amino acids

      2 to 372
    • Tags

      His-T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134847 was expressed in E. coli as inclusion bodies, refolded, chromatographically purified and sterile-filtered.
  • Form

    Liquid
  • Additional notes

    Previously labelled as macroH2A.1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Buffer also conatins a proprietary formulation of NaCl, KCl, EDTA, Arginine, DTT and Glycerol.

General Info

  • Alternative names

    • Core histone macro h2a.1
    • Core histone macro-H2A.1
    • H2A histone family member Y
    • H2A.y
    • H2A/y
    • H2AF12M
    • H2AFJ
    • H2afy
    • H2AY_HUMAN
    • Histone H2A.Y
    • Histone macroH2A1
    • Histone macroH2A1.1
    • Histone macroH2A1.2
    • Macroh2a1
    • MACROH2A1.1
    • MacroH2A1.2
    • Medulloblastoma antigen MU MB 50.205
    • Medulloblastoma antigen MU-MB-50.205
    • mH2a
    • mH2A1
    see all
  • Function

    Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Involved in stable X chromosome inactivation. Inhibits the binding of transcription factors and interferes with the activity of remodeling SWI/SNF complexes. Inhibits histone acetylation by EP300 and recruits class I HDACs, which induces an hypoacetylated state of chromatin. In addition, isoform 1, but not isoform 2, binds ADP-ribose and O-acetyl-ADP-ribose, and may be involved in ADP-ribose-mediated chromatin modulation.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 histone H2A domain.
    Contains 1 Macro domain.
  • Post-translational
    modifications

    Monoubiquitinated at either Lys-116 or Lys-117. May also be polyubiquitinated. Ubiquitination is mediated by the CUL3/SPOP E3 complex and does not promote proteasomal degradation. Instead, it is required for enrichment in inactive X chromosome chromatin.
  • Cellular localization

    Nucleus. Chromosome. Enriched in inactive X chromosome chromatin and in senescence-associated heterochromatin.
  • Information by UniProt

References

ab134847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up