Overview

  • Product name

    Recombinant Human mH2A2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMA AVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTI ASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSK AAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLT QSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRK SQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSA AEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVY FLLFDSESIGIYVQEMAKLDAK
    • Molecular weight

      67 kDa including tags
    • Amino acids

      1 to 372

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.

    Previously labelled as Macro H2A.2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Core histone macro H2A2.2
    • Core histone macro-H2A.2
    • Core histone macroH2A2.2
    • H2A histone family member Y2
    • H2AFY2
    • H2AW_HUMAN
    • Histone macroH2A2
    • Macro H2A.2
    • Macro H2A2
    • MacroH2A.2
    • MacroH2A2
    • mH2A2
    see all
  • Function

    Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation.
  • Sequence similarities

    Contains 1 histone H2A domain.
    Contains 1 Macro domain.
  • Cellular localization

    Nucleus. Chromosome. Enriched in inactive X chromosome chromatin and in senescence-associated heterochromatin.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue, showing ab131967.

References

ab131967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up