Recombinant human MHC Class II Ia protein (BSA and azide free) (ab174039)

Overview

  • Product name
    Recombinant human MHC Class II Ia protein (BSA and azide free)
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGA LPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNT METIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGV TKQDLGPVPM
    • Molecular weight
      19 kDa including tags
    • Amino acids
      73 to 232
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_004346.1)

Specifications

Our Abpromise guarantee covers the use of ab174039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA.

    Immobilized Human MHC Class II Ia at 5 μg/ml (100 μl/well) can bind biotinylated Human Cathepsin L1 with a linear range of 3.2 - 500 ng/ml.

  • Applications

    ELISA

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes

    Lyophilized from 0.22 μm filtered solution.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CD 74
    • CD74
    • CD74 antigen
    • CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
    • CD74 molecule
    • CD74 molecule, major histocompatibility complex, class II invariant
    • CLIP
    • DHLAG
    • Gamma chain of class II antigens
    • HG2A_HUMAN
    • HLA class II histocompatibility antigen gamma chain
    • HLA DR antigens associated invariant chain
    • HLA DR gamma
    • HLA-DR antigens-associated invariant chain
    • HLADG
    • Ia antigen associated invariant chain
    • Ia antigen-associated invariant chain
    • Ia associated invariant chain
    • Ia gamma
    • Ii
    • Invariant polpypeptide of major histocompatibility class II antigen associated
    • INVG34
    • La associated invariant chain
    • La gamma
    • Major histocompatibility complex class II invariant chain
    • MHC HLA DR gamma chain
    • p33
    • Probable protein disulfide isomerase ER60 precursor
    • Protein 41
    see all
  • Function
    Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.
  • Sequence similarities
    Contains 1 thyroglobulin type-1 domain.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus > trans-Golgi network. Endosome. Lysosome. Transits through a number of intracellular compartments in the endocytic pathway. It can either undergo proteolysis or reach the cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of MHC Class II Ia in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 23-33 kDa due to glycosylation.

References

ab174039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up