Description

  • Product name

    Recombinant Human Mib1/Mindbomb protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIK EQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
    • Amino acids

      909 to 1006
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DAPK-interacting protein 1
    • Dip 1
    • DIP-1
    • Dip1
    • E3 ubiquitin protein ligase MIB 1
    • E3 ubiquitin protein ligase MIB1
    • E3 ubiquitin-protein ligase mib1
    • KIAA1323
    • LVNC7
    • MIB
    • mib1
    • MIB1_HUMAN
    • Mind bomb homolog 1
    • Mindbomb E3 ubiquitin protein ligase 1
    • Ubiquitin ligase mind bomb
    • Zinc finger ZZ type with ankyrin repeat domain protein 2
    • ZZANK2
    • ZZZ6
    see all
  • Function

    E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis.
  • Tissue specificity

    Widely expressed at low level. Expressed at higher level in spinal cord, ovary, whole brain, and all specific brain regions examined.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 9 ANK repeats.
    Contains 2 MIB/HERC2 domains.
    Contains 3 RING-type zinc fingers.
    Contains 1 ZZ-type zinc finger.
  • Post-translational
    modifications

    Ubiquitinated. Possibly via autoubiquitination.
  • Cellular localization

    Cytoplasm. Cell membrane. Localizes to the plasma membrane (By similarity). According to PubMed:15048887, it is mitochondrial, however such localization remains unclear.
  • Information by UniProt

Images

  • ab153455 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up