Description

  • Product name

    Recombinant Human MIEF2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRF IDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSS SAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAK QLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPL VLEPGLWSLVPGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLS SRVLLELLRKALAASVNWPAIGSLLGCLIRPSMASEELLLEVQHERLELT VAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDA GTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGER FLQALELLIGSLEQASLPCHFNPSVNLFSSLREEEIDDIGYALYSGLQEP EGLL
    • Amino acids

      1 to 454
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SMCR7

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC23130
    • MID49
    • MID49_HUMAN
    • MIEF2
    • Mitochondrial dynamic protein MID49
    • Mitochondrial dynamic protein of 49 kDa
    • Mitochondrial dynamics protein MID49
    • Mitochondrial dynamics protein of 49 kDa
    • Mitochondrial elongation factor 2
    • Smith Magenis syndrome chromosome region candidate 7
    • Smith-Magenis syndrome chromosomal region candidate gene 7 protein
    see all
  • Function

    Mitochondrial outer membrane protein which regulates mitochondrial fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity.
  • Tissue specificity

    Expressed in all tissues tested with highest expression in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the MID49/MID51 family.
  • Cellular localization

    Mitochondrion outer membrane. Colocalizes with DNM1L at mitochondrial membrane. Forms foci and rings around mitochondria.
  • Information by UniProt

Images

  • ab165233 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up