Recombinant Human MIF4GD protein (ab163547)

Overview

  • Product name
    Recombinant Human MIF4GD protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR LMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAE SKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLR VNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMN GQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYY YSEVSD
    • Amino acids
      1 to 256
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AD023
    • hSLIP1
    • MI4GD_HUMAN
    • MIF4G domain containing
    • MIF4G domain-containing protein
    • Mif4gd
    • MIFD
    • SLBP (stem loop binding protein) interacting protein 1
    • SLBP-interacting protein 1
    • SLIP1
    see all
  • Function
    Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation.
  • Sequence similarities
    Belongs to the MIF4GD family.
    Contains 1 MIF4G domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab163547 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up