Description

  • Product name

    Recombinant Human Mimitin protein
  • Purity

    > 85 % SDS-PAGE.
    ab109967 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGWSQDLFRALWRSLSREVKEHVGTDQFGN KYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRK TPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIK GHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 169
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.116% Sodium chloride

General Info

  • Alternative names

    • B17.2 like
    • B17.2-like
    • B17.2L
    • FLJ22398
    • MIMIT_HUMAN
    • Mimitin
    • Mimitin mitochondrial
    • mitochondrial
    • MMTN
    • Myc induced mitochondrial protein
    • Myc-induced mitochondrial protein
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 2
    • NADH dehydrogenase (ubiquinone) complex I, assembly factor 2
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2
    • NDUFA12 like
    • NDUFA12 like protein
    • NDUFA12-like protein
    • NDUFA12L
    • NDUFAF2
    • OTTHUMP00000161882
    • OTTHUMP00000221703
    see all
  • Function

    Acts as a molecular chaperone for mitochondrial complex I assembly.
  • Tissue specificity

    Highly expressed in ESCC cells. Also expressed in heart, skeletal muscle, liver, and in fibroblasts.
  • Involvement in disease

    Defects in NDUFAF2 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similarities

    Belongs to the complex I NDUFA12 subunit family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab109967.

References

ab109967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up