Overview

  • Product name
    Recombinant Human MINPP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNE KVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL
    • Amino acids
      391 to 487
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3
    • 4
    • 5)-tetrakisphosphate 3-phosphatase
    • 5)P(4) 3-phosphatase
    • DKFZp564L2016
    • HIPER1
    • Inositol (1
    • inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase
    • Ins(1
    • ins(1,3,4,5)P(4) 3-phosphatase
    • MINP1_HUMAN
    • Minpp1
    • MINPP2
    • MIPP
    • Multiple inositol polyphosphate histidine phosphatase, 1
    • Multiple inositol polyphosphate phosphatase 1
    • multiple inositol polyphosphate phosphatase 2
    see all
  • Function
    Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6) (By similarity). May play a role in bone development (endochondral ossification).
  • Tissue specificity
    Widely expressed with highest levels in kidney, liver and placenta.
  • Involvement in disease
    Note=Defects in MINPP1 may be involved in follicular thyroid tumors development.
  • Cellular localization
    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • ab160547 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up