Description

  • Product name

    Recombinant Human MINPP1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTP VQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAA LADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLI TSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFD HCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYT INSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSL MGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKE QFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARA NSTSDEL
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      31 to 487
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab241455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 3
    • 4
    • 5)-tetrakisphosphate 3-phosphatase
    • 5)P(4) 3-phosphatase
    • DKFZp564L2016
    • HIPER1
    • Inositol (1
    • inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase
    • Ins(1
    • ins(1,3,4,5)P(4) 3-phosphatase
    • MINP1_HUMAN
    • Minpp1
    • MINPP2
    • MIPP
    • Multiple inositol polyphosphate histidine phosphatase, 1
    • Multiple inositol polyphosphate phosphatase 1
    • multiple inositol polyphosphate phosphatase 2
    see all
  • Function

    Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6) (By similarity). May play a role in bone development (endochondral ossification).
  • Tissue specificity

    Widely expressed with highest levels in kidney, liver and placenta.
  • Involvement in disease

    Note=Defects in MINPP1 may be involved in follicular thyroid tumors development.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • Analysis of ab241455 by (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab241455 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up