Description

  • Product name

    Recombinant Human MIRO2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEK VPTHIVDYSEAEQTDEELREEIHKANVVCVVYDVSEEATIEKIRTKWIPL VNGGTTQGPRVPIILVGNKSDLRSGSSMEAVLPIMSQFPEIETCVECSAK NLRNISELFYYAQKAVLHPTAPLYDPEAKQLRPACAQALTRIFRLSDQDL DQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDG FLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTE LNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVR TEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVT REKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQP PGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKS FAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPA PVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGA AVAAVLSFSLYRVLVKSQ
    • Predicted molecular weight

      95 kDa including tags
    • Amino acids

      1 to 618

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARHT2
    • C16orf39
    • hMiro 2
    • hMiro-2
    • hMiro2
    • MIRO-2
    • MIRO2_HUMAN
    • Mitochondrial Rho GTPase 2
    • Ras homolog gene family member T2
    • RASL
    • RHOT2
    see all
  • Function

    Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
  • Tissue specificity

    Ubiquitously expressed. Highly expressed in heart, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the mitochondrial Rho GTPase family.
    Contains 2 EF-hand domains.
    Contains 2 Miro domains.
  • Cellular localization

    Mitochondrion outer membrane. Colocalizes with MGARP and RHOT2 at the mitochondria.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132740 stained with Coomassie Blue.

References

ab132740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up