Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGI PDCDISPVQIRKCTEKFLCFMKGHFDNLFSKMEQLFLQLILRIPSNILLP EDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLAELEEQKIVQA KLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESK RLKIS
    • Molecular weight

      51 kDa including tags
    • Amino acids

      1 to 205

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hMIS12
    • homolog of yeast Mis12
    • KNTC2AP
    • MIND kinetochore complex component, homolog (yeast)
    • MIS12 homolog
    • MIS12 homolog (yeast)
    • MIS12 MIND kinetochore complex component homolog (yeast)
    • MTW 1
    • MTW1
    • Protein MIS12 homolog
    see all
  • Relevance

    MIS12 is part of a complex that plays an essential role in chromosome segregation in vertebrates and contributes to mitotic kinetochore assembly.
  • Cellular localization

    Nucleus. Associated with the kinetochore.

Images

  • 12.5% SDS-PAGE analysis of ab132492 stained with Coomassie Blue.

References

ab132492 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up