Recombinant Human MIST-1 protein (Tagged) (ab165804)

Overview

  • Product name
    Recombinant Human MIST-1 protein (Tagged)
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYI KSLTATILTMSSSRLP
    • Amino acids
      75 to 140
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously known as BHLHA15.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic helix loop helix domain containing class B 8
    • Basic helix loop helix family member a15
    • BHA15_HUMAN
    • Bhlha15
    • bHLHB8
    • Class A basic helix-loop-helix protein 15
    • Class B basic helix-loop-helix protein 8
    • Class II bHLH protein MIST1
    • intestine and stomach expression 1
    • MIST 1
    • MIST-1
    • MIST1
    • Muscle
    • Muscle intestine and stomach expression 1
    • protein MIST1
    see all
  • Function
    Plays a role in controlling the transcriptional activity of MYOD1, ensuring that expanding myoblast populations remain undifferentiated. Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3'.
  • Tissue specificity
    Expressed in brain, liver, spleen and skeletal muscle.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Domain
    Lacks a classic transcription activation domain and instead possesses an N-terminal region capable of inhibiting heterologous activators.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165804 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up