Description

  • Product name

    Recombinant Human Mitochondrial Ferritin protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDF LETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN
    • Amino acids

      143 to 242
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FerH
    • Ferritin
    • Ferritin H subunit
    • Ferritin, mitochondrial
    • Fth 3
    • Fth3
    • FTMT
    • FTMT_HUMAN
    • mitochondrial
    • Mitochondrial ferritin
    • MTF
    • OTTHUMP00000159158
    see all
  • Function

    Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.
  • Tissue specificity

    Detected in testis and erythroleukemia. Expression is very low or not detectable in brain, colon, heart, kidney, liver, lung, muscle, placental, spleen and small intestine.
  • Sequence similarities

    Belongs to the ferritin family.
    Contains 1 ferritin-like diiron domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab164960 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up