Overview

  • Product name

    Recombinant Human Mitofusin 1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIAT EDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKV LPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDK DLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDAD VFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYME DVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMP ESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILAT VKNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRNQMNLLTLDVKKKIKE VTEEVANKVSCAMTDEICRLSVLVDEFCSEFHPNPDVLKIYKSELNKHIE DGMGRNLADRCTDEVNALVLQTQQEIIENLKPLLPAGIQDKLHTLIPCKK FDLSYNLNYHKLCSDFQEDIVFRFSLGWSSLVHRFLGPRNAQRVLLGLSE PIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGLASVTSRTSMGII IVGGVIWKTIGWKLLSVSLTMYGALYLYERLSWTTHAKERAFKQQFVNYA TEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPK EIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES
    • Molecular weight

      107 kDa including tags
    • Amino acids

      1 to 741

Specifications

Our Abpromise guarantee covers the use of ab132635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Fzo homolog
    • Hfzo1
    • Hfzo2
    • MFN 1
    • Mfn1
    • MFN1_HUMAN
    • Mitochondrial transmembrane GTPase Fzo 1
    • Mitochondrial transmembrane GTPase FZO 2
    • Mitochondrial transmembrane GTPase FZO1B
    • Mitofusin 1
    • Mitofusin-1
    • Mitofusin1
    • MS996
    • Putative transmembrane GTPase
    • Transmembrane GTPase MFN1
    see all
  • Function

    Essential transmembrane GTPase, which mediates mitochondrial fusion. Fusion of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. MFN1 acts independently of the cytoskeleton. Overexpression induces the formation of mitochondrial networks.
  • Tissue specificity

    Ubiquitous. Expressed at slightly higher level in kidney and heart. Isoform 2 may be overexpressed in some tumors, such as lung cancers.
  • Sequence similarities

    Belongs to the mitofusin family.
  • Post-translational
    modifications

    Ubiquitinated by MARCH5.
  • Cellular localization

    Cytoplasm and Mitochondrion outer membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132635 stained with Coomassie Blue.

References

This product has been referenced in:

  • Kristensen MD  et al. Obesity leads to impairments in the morphology and organization of human skeletal muscle lipid droplets and mitochondrial networks, which are resolved with gastric bypass surgery-induced improvements in insulin sensitivity. Acta Physiol (Oxf) N/A:e13100 (2018). Read more (PubMed: 29791782) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up