Overview

  • Product name

    Recombinant Human MitoNEET protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSKRFYVKDHRNKAMINLHIQKDNPKIVH AFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
    • Molecular weight

      11 kDa including tags
    • Amino acids

      32 to 108
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab134545 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as CISD1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • AU043990
    • AW743335
    • C10orf70
    • CDGSH iron sulfur domain 1
    • CDGSH iron-sulfur domain-containing protein 1
    • CISD 1
    • CISD1
    • CISD1_HUMAN
    • D10Ertd214e
    • MDS029
    • MGC14684
    • MitoNEET
    • RGD1309529
    • ZCD1
    • Zinc finger CDGSH type domain 1
    see all
  • Function

    Plays a key role in regulating maximal capacity for electron transport and oxidative phosphorylation (By similarity). May be involved in Fe-S cluster shuttling and/or in redox reactions.
  • Tissue specificity

    Expression is reduced in cells derived from cystic fibrosis patients.
  • Sequence similarities

    Belongs to the CISD protein family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134545.

References

ab134545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up