Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFMDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPK KYAVTDDYQLSKQV LGLGVNGKVLECFHRRTGQKCALKLLYDSPKARQ EVDHHWQASGGPHIVCILDVYENMHHGKRC LLIIMECMEGGELFSRIQ ERGDQAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSK EK DAVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLG VIMYILLCGFPP FYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDA KQLIRLLLKTDPTERLTITQFMNHPWIN QSMVVPQTPLHTARVLQEDK DHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQ AGSS SASQGCNNQ
    • Molecular weight
      45 kDa including tags
    • Amino acids
      1 to 382
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169914 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names
    • 3pK
    • anti MAPKAPK3
    • Chromosome 3p kinase
    • EC 2.7.11.1
    • MAP kinase-activated protein kinase 3
    • MAPK activated protein kinase 3
    • MAPK-activated protein kinase 3
    • MAPK3_HUMAN
    • MAPKAP
    • MAPKAP kinase 3
    • MAPKAP-K3
    • MAPKAP3
    • MAPKAPK 3
    • MAPKAPK-3
    • Mapkapk3
    • MAPKAPK3 antibody
    • Mitogen activated protein kinase activated protein kinase
    • Mitogen activated protein kinase activated protein kinase 3
    • MK-3
    see all
  • Function
    Stress-activated serine/threonine-protein kinase involved in cytokines production, endocytosis, cell migration, chromatin remodeling and transcriptional regulation. Following stress, it is phosphorylated and activated by MAP kinase p38-alpha/MAPK14, leading to phosphorylation of substrates. Phosphorylates serine in the peptide sequence, Hyd-X-R-X(2)-S, where Hyd is a large hydrophobic residue. MAPKAPK2 and MAPKAPK3, share the same function and substrate specificity, but MAPKAPK3 kinase activity and level in protein expression are lower compared to MAPKAPK2. Phosphorylates HSP27/HSPB1, KRT18, KRT20, RCSD1, RPS6KA3, TAB3 and TTP/ZFP36. Mediates phosphorylation of HSP27/HSPB1 in response to stress, leading to dissociate HSP27/HSPB1 from large small heat-shock protein (sHsps) oligomers and impair their chaperone activities and ability to protect against oxidative stress effectively. Involved in inflammatory response by regulating tumor necrosis factor (TNF) and IL6 production post-transcriptionally: acts by phosphorylating AU-rich elements (AREs)-binding proteins, such as TTP/ZFP36, leading to regulate the stability and translation of TNF and IL6 mRNAs. Phosphorylation of TTP/ZFP36, a major post-transcriptional regulator of TNF, promotes its binding to 14-3-3 proteins and reduces its ARE mRNA affinity leading to inhibition of dependent degradation of ARE-containing transcript. Involved in toll-like receptor signaling pathway (TLR) in dendritic cells: required for acute TLR-induced macropinocytosis by phosphorylating and activating RPS6KA3. Also acts as a modulator of Polycomb-mediated repression.
  • Tissue specificity
    Widely expressed, with a higher expression level observed in heart and skeletal muscle. No expression in brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated and activated by MAPK1/ERK2 and MAPK3/ERK1. Phosphorylated and activated by MAP kinase p38-alpha/MAPK14 at Thr-201, Ser-251 and Thr-313.
  • Cellular localization
    Nucleus. Cytoplasm. Predominantly located in the nucleus, when activated it translocates to the cytoplasm.
  • Information by UniProt

References

ab169914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up