Description

  • Product name

    Recombinant Human MKRN1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDG SGGGWTKQVTCRYFMHGVCKEGDNCRYSHDLSDSPYSVVCKYFQRGYCIY GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE SRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEES EKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQLLHPMDAA QRSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFG ILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEE KEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEP QRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVVTFELGEMLLM LLAAGGDDELTDSEDEWDLFHDELEDFYDLDL
    • Amino acids

      1 to 482
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • E3 ubiquitin-protein ligase makorin-1
    • FLJ21334
    • HGNC:7112
    • Makorin
    • Makorin ring finger protein 1
    • MKRN 1
    • mkrn1
    • MKRN1_HUMAN
    • OTTHUMP00000212117
    • OTTHUMP00000212118
    • OTTHUMP00000212121
    • OTTHUMP00000212124
    • Ring finger protein 1
    • RING finger protein 61
    • RNF61
    see all
  • Function

    E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include FILIP1, p53/TP53, CDKN1A and TERT. Keeps cells alive by suppressing p53/TP53 under normal conditions, but stimulates apoptosis by repressing CDKN1A under stress conditions. Acts as a negative regulator of telomerase. Has negative and positive effects on RNA polymerase II-dependent transcription.
  • Tissue specificity

    Ubiquitous.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 4 C3H1-type zinc fingers.
    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    Auto-ubiquitinated; which leads to proteasomal degradation.
  • Information by UniProt

Images

  • ab161710 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up