Overview

  • Product name

    Recombinant Human MLD protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMM VLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNC KAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEG WFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILI YYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLN LLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDF VMDDTISPYSRMKRHQKGEMVLE
    • Amino acids

      1 to 323
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160100 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as DEGS1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Degenerative spermatocyte homolog 1
    • Degenerative spermatocyte homolog 1 lipid desaturase
    • Degenerative spermatocyte homolog lipid desaturase
    • DEGS
    • DEGS 1
    • Delta 4 desaturase sphingolipid 1
    • Des 1
    • DES1
    • Dihydroceramide desaturase
    • FADS7
    • Membrane fatty acid (lipid) desaturase
    • Membrane lipid desaturase
    • MGC5079
    • MIG15
    • Migration inducing gene 15 protein
    • MLD
    • Sphingolipid delta 4 desaturase
    • Sphingolipid delta(4) desaturase DES1
    see all
  • Relevance

    DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. It contains three His containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It has sphingolipid-delta-4-desaturase activity and converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine).
  • Cellular localization

    Endoplasmic reticulum and Mitochondrial

Images

  • ab160100 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160100 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160100.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up