Recombinant Human MLF1 Interacting Protein/PBIP1 (ab164074)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKM LKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYD ELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLF KARTLLGAESHLRNINHQLEKLLDQG
    • Amino acids
      1 to 176
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CENP U
    • CENP-50
    • CENP-U
    • CENP50
    • CENPU
    • CENPU_HUMAN
    • CENPU50
    • centromere protein of 50 kDa
    • Centromere protein U
    • FLJ23468
    • HHV8 LNAIP1
    • ICEN24
    • Interphase centromere complex protein 24
    • Kaposi Sarcoma Herpesvirus latent nuclear antigen interacting protein 1
    • KLIP-1
    • KLIP1
    • KSHV latent nuclear antigen interacting protein 1
    • KSHV latent nuclear antigen-interacting protein 1
    • KSHV LNAIP1
    • LNAIP 1
    • LNAIP-1
    • MLF1-interacting protein
    • MLF1IP
    • MLF1IP1
    • PBIP1
    • Polo-box-interacting protein 1
    see all
  • Function
    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Plays an important role in the correct PLK1 localization to the mitotic kinetochores. A scaffold protein responsible for the initial recruitment and maintenance of the kinetochore PLK1 population until its degradation. Involved in transcriptional repression.
  • Tissue specificity
    Expressed at high levels in the testis, fetal liver, thymus, bone marrow and at lower levels in the lymph nodes, placenta, colon and spleen. Present in all cell lines examined, including B-cells, T-cells, epithelial cells and fibroblast cells. Expressed at high levels in glioblastoma cell lines.
  • Post-translational
    modifications
    Phosphorylated by PLK1 at Thr-78, creating a self-tethering site that specifically interacts with the polo-box domain of PLK1.
  • Cellular localization
    Cytoplasm. Nucleus. Chromosome > centromere > kinetochore. Localizes in the kinetochore domain of centromeres. Colocalizes with PLK1 at the interzone between the inner and the outer kinetochore plates.
  • Information by UniProt

Images

  • ab164074 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up